
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: P00335
Gene Names: rbtD
Organism: Enterobacter aerogenes (Aerobacter aerogenes)
AA Sequence: MKHSVSSMNTSLSGKVAAITGAASGIGLECARTLLGAGAKVVLIDREGEKLNKLVAELGENAFALQVDLMQADQVDNLLQGILQLTGRLDIFHANAGAYIGGPVAEGDPDVWDRVLHLNINAAFRCVRSVLPHLIAQKSGDIIFTAVIAGVVPVIWEPVYTASKFAVQAFVHTTRRQVAQYGVRVGAVLPGPVVTALLDDWPKAKMDEALANGSLMQPIEVAESVLFMVTRSKNVTVRDIVILPNSVDL
Expression Region: 1-249aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 30.5 kDa
Alternative Name(s):
Relevance:
Reference: Ribitol dehydrogenase of Klebsiella aerogenes. Sequence and properties of wild-type and mutant strains.Dothie J.M., Giglio J.R., Moore C.H., Taylor S.S., Hartley B.S.Biochem. J. 230:569-578(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Enterobacter aerogenes Methyl-accepting chemotaxis serine transducer(tse)
- Regular price
- €1.352,95 EUR
- Sale price
- €1.352,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Bovine L-2-hydroxyglutarate dehydrogenase, mitochondrial(L2HGDH)
- Regular price
- €750,95 EUR
- Sale price
- €750,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Enterobacter aerogenes Methyl-accepting chemotaxis aspartate transducer(tas)
- Regular price
- €1.337,95 EUR
- Sale price
- €1.337,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Lysobacter enzymogenes Lysyl endopeptidase
- Regular price
- €724,95 EUR
- Sale price
- €724,95 EUR
- Regular price
-
- Unit price
- per
Sold out