Recombinant Dog Interleukin-18(IL18)

Recombinant Dog Interleukin-18(IL18)

CSB-EP895937DO
Regular price
€784,95 EUR
Sale price
€784,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein: IL18

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Canis lupus familiaris (Dog) (Canis familiaris)

Delivery time: 3-7 business days

Uniprot ID: Q9XSR0

AA Sequence: YFGKLEPKLSIIRNLNDQVLFVNEGNQPVFEDMPDSDCTDNAPHTIFIIYMYKDSLTRGLAVTISVKYKTMSTLSCKNKTISFQKMSPPDSINDEGNDIIFFQRSVPGHDDKIQFESSLYKGHFLACKKENDLFKLILKDKDENGDKSIMFTVQNKS

Tag info: N-terminal 6xHis-tagged

Expression Region: 37-193aa

Protein length: Full Length

MW: 22 kDa

Alternative Name(s): Interferon gamma-inducing factor ;IFN-gamma-inducing factorInterleukin-1 gamma ;IL-1 gamma

Relevance: Augments natural killer cell activity in spleen cells and stimulates interferon gamma production in T-helper type I cells.

Reference: Cloning, sequencing, and characterization of dog interleukin-18.Argyle D.J., McGillivery C., Nicolson L., Onions D.E.Immunogenetics 49:541-543(1999)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share