
Size:50 ug. Other sizes are also available. Please Inquire.
Product Type:Recombinant Protein
Species:Desulforudis audaxviator (strain MP104C)
Uniprot NO.:B1I461
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MSALAVILVIGLSYLVGSVPTGYLIARHVKGIDIRGHGSGNIGATNVWRTLGPGWGLASL VGDTAKGIVAVLLGRAVGVPGLELLTGAAALTGHGWSVFLRFQGGKIIATSLGVLIMLPP VALATAAAVWIAVLALTRYVSLASIIAASSVPLAFALGGVGWRHVLFGLFLALVAVYKHR ANIDRLLKGKESRFSFRK
Protein Names:Recommended name: Glycerol-3-phosphate acyltransferase Alternative name(s): Acyl-PO4 G3P acyltransferase Acyl-phosphate--glycerol-3-phosphate acyltransferase G3P acyltransferase Short name= GPAT EC= 2.3.1.n3 Lysophosphati
Gene Names:Name:plsY Ordered Locus Names:Daud_1171
Expression Region:1-198
Sequence Info:full length protein
You may also like
-
Recombinant Desulfotalea psychrophila Glycerol-3-phosphate acyltransferase(plsY)
- Regular price
- €1.083,95 EUR
- Sale price
- €1.083,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Desulfovibrio desulfuricans Glycerol-3-phosphate acyltransferase(plsY)
- Regular price
- €1.102,95 EUR
- Sale price
- €1.102,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Glycerol-3-phosphate acyltransferase(plsY)
- Regular price
- €1.087,95 EUR
- Sale price
- €1.087,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Glycerol-3-phosphate acyltransferase(plsY)
- Regular price
- €1.084,95 EUR
- Sale price
- €1.084,95 EUR
- Regular price
-
- Unit price
- per
Sold out