Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: Yes
Lead time: 3-7 working days
Research Topic: Others
Uniprot ID: Q762I5
Gene Names: RETN
Organism: Bos taurus (Bovine)
AA Sequence: QSLCPIDKAISEKIQEVTTSLVPGAVRIIGLDCRSVTSRGSLVTCPSGFAVTGCTCGSACGSWDVRAETTCHCQCAGMDWTGARCCRLHIQ
Expression Region: 19-109aa
Sequence Info: Full Length
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 13.6 kDa
Alternative Name(s):
Relevance: Hormone that ses to suppress insulin ability to stimulate glucose uptake into adipose cells. Potentially links obesity to diabetes .
Reference: Gene expression of resistin and TNF-alpha in adipose tissue of Japanese Black steers and Holstein steers.Komatsu T., Itoh F., Hodate K., Hazegawa S., Obara Y., Kushibiki S.Anim. Sci. J. 76:567-573(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.