Recombinant Blattella germanica Allergen Bla g 4

Recombinant Blattella germanica Allergen Bla g 4

CSB-EP346597BTL
Regular price
€794,95 EUR
Sale price
€794,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Blattella germanica (German cockroach) (Blatta germanica)

Delivery time: 3-7 business days

Uniprot ID: P54962

AA Sequence: NEDCFRHESLVPNLDYERFRGSWIIAAGTSEALTQYKCWIDRFSYDDALVSKYTDSQGKNRTTIRGRTKFEGNKFTIDYNDKGKAFSAPYSVLATDYENYAIVEGCPAAANGHVIYVQIRFSVRRFHPKLGDKEMIQHYTLDQVNQHKKAIEEDLKHFNLKYEDLHSTCH

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 13-182aa

Protein length: Full Length

MW: 35.8 kDa

Alternative Name(s): Allergen Bla g IV Allergen: Bla g 4

Relevance: Probable ligand-binding protein.

Reference: "Cloning of cockroach allergen, Bla g 4, identifies ligand binding proteins (or calycins) as a cause of IgE antibody responses."Arruda L.K., Vailes L.D., Hayden M.L., Benjamin D.C., Chapman M.D.J. Biol. Chem. 270:31196-31201(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share