Recombinant Androctonus mauretanicus mauretanicus Alpha-toxin Amm8

Recombinant Androctonus mauretanicus mauretanicus Alpha-toxin Amm8

CSB-EP773772AKB
Regular price
€775,95 EUR
Sale price
€775,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:Q7YXD3

Gene Names:N/A

Organism:Androctonus mauritanicus mauritanicus(Scorpion)

AA Sequence:LKDGYIVNDINCTYFCGRNAYCNELCIKLKGESGYCQWASPYGNSCYCYKLPDHVRTKGPGRCND

Expression Region:20-84aa

Sequence Info:Full Length of Mature Protein

Source:E.coli

Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW:14.8 kDa

Alternative Name(s):Alpha-anatoxin Amm VIII (Amm VIII) (AmmVIII) (Neurotoxin 8) (P4)

Relevance:Alpha toxins bind voltage-independently at site-3 of sodium channels and inhibit the inactivation of the activated channels, thereby blocking neuronal transmission . The toxin principally slows the inactivation process of TTX-sensitive sodium channels . It discriminates neuronal versus muscular sodium channel, as it is more potent on rat brain Nav1.2/SCN2A than on rat skeletal muscle Nav1.4/SCN4A . It also shows a weak activity on Nav1.7/SCN9A . In vivo, the toxin produces pain hypersensibility to mechanical and thermal stimuli.. It also exhibits potent analgesic activity, increasing hot plate and tail flick withdrawal latencies in a dose-dependent fashion . This paradoxical analgesic action, is significantly suppressed by opioid receptor antagonists, suggesting a pain-induced analgesia mechanism that involves an endogenous opioid system . This led to hypothesis that pain relief induced by peripheral administration of Amm VIII may result from sensitization of primary afferent neurons and subsequent activation of an opioid-dependent noxious inhibitory control .

Reference:"New analysis of the toxic compounds from the Androctonus mauretanicus mauretanicus scorpion venom." Oukkache N., Rosso J.-P., Alami M., Ghalim N., Saile R., Hassar M., Bougis P.E., Martin-Eauclaire M.-F. Toxicon 51:835-852(2008)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:13-23 business days

Your list is ready to share