Recombinan Bombyx mori Cecropin-D(CECD)

Recombinan Bombyx mori Cecropin-D(CECD)

CSB-CF524922BTT
Regular price
€883,95 EUR
Sale price
€883,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:O76146

Gene Names:CECD

Organism:Bombyx mori (Silk moth)

AA Sequence:GNFFKDLEKMGQRVRDAVISAAPAVDTLAKAKALGQ

Expression Region:25-60aa

Sequence Info:Full Length of Mature Protein

Source:in vitro E.coli expression system

Tag Info:N-terminal 6xHis-tagged

MW:7.8 kDa

Alternative Name(s):CECDCecropin-D

Relevance:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Reference:"cDNA cloning and gene expression of cecropin D, an antibacterial protein in the silkworm, Bombyx mori." Yang J., Furukawa S., Sagisaka A., Ishibashi J., Taniai K., Shono T., Yamakawa M. Comp. Biochem. Physiol. 122B:409-414(1999)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:Cecropins have lytic and antibacterial activity against several Gram-positive and Gram-negative bacteria.

Involvement in disease:

Subcellular Location:Secreted

Protein Families:Cecropin family

Tissue Specificity:Mainly in fat body. Lower in hemocytes. Not expressed in midguts, malpighian tubules and silk glands.

Paythway:

HGNC Database Link:

UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Bmo&CID=271

KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?bmor:692369

STRING Database Link:https://string-db.org/network/7091.BGIBMGA000017-TA

OMIM Database Link:

Lead Time Guidance:18-23 business days

Your list is ready to share