
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Microbiology
Target / Protein:
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Yersinia enterocolitica
Delivery time: 3-7 business days
Uniprot ID: P19196
AA Sequence: VNGEQFATDKGFPKTTFNKATFQLVMNDDVANNTQYDWTSSYAASAPVDNQGKVNIAYKTYGSTVTVTAKSKKFPSYTATYQFKPNLWVFSGTMSLQSSVEASRNCQRTDFTALIESARASNGSRSPDGTLWGEWGSLATYDSAEWPSGNYWTKKTSTDFVTMDMTTGDIPTSAATAYPLCAEPQ
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 651-835aa
Protein length: Partial
MW: 36.3 kDa
Alternative Name(s):
Relevance: Invasin is a protein that allows enteric bacteria to penetrate cultured mammalian cells. The entry of invasin in the cell is mediated by binding several beta-1 chain integrins.
Reference: "Sequence, localization and function of the invasin protein of Yersinia enterocolitica."Young V.B., Miller V.L., Falkow S., Schoolnik G.K.Mol. Microbiol. 4:1119-1128(1990).
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Yersinia enterocolitica Invasin,partial
- Regular price
- €749,95 EUR
- Sale price
- €749,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Attachment invasion locus protein(ail)
- Regular price
- €749,95 EUR
- Sale price
- €749,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Attachment invasion locus protein(ail)
- Regular price
- €749,95 EUR
- Sale price
- €749,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Yersinia enterocolitica Protein YopB(yopB)
- Regular price
- €893,95 EUR
- Sale price
- €893,95 EUR
- Regular price
-
- Unit price
- per
Sold out