Recombinant Vesicular stomatitis Indiana virus Protein C'(P)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Vesicular stomatitis Indiana virus Protein C'(P)

CSB-EP768100VBH
Regular price
€617,95 EUR
Sale price
€617,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Others

Uniprot ID: Q86132

Gene Names: p

Organism: Vesicular stomatitis Indiana virus (strain Mudd-Summers) (VSIV)

AA Sequence: MRSKHNELKSPIMSCSKRTEWKSILGPLIFRQQMILTQNLNQKLKTIKACMYQIRKLSKLKALYRGL

Expression Region: 1-67aa

Sequence Info: Full Length

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

MW: 11.9 kDa

Alternative Name(s):

Relevance: May play a role in viral pathogenesis or transmission by insects vectors.

Reference: "Cloning and expression of a viral phosphoprotein: structure suggests vesicular stomatitis virus NS may function by mimicking an RNA template." Hudson L.D., Condra C., Lazzarini R.A. J. Gen. Virol. 67:1571-1579(1986)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share