
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 20ug
Updated Date: Stock Protein updated on 20170405
Research areas: Others
Target / Protein: A673_03341
Biologically active: Not Tested
Expression system: Mammalian cell
Species of origin: Salmonella enterica subsp. enterica serovar Enteritidis str. 2009K0958
Delivery time: 3-7 business days
Uniprot ID: S4JJH7
AA Sequence: DVQEAKLRDKMRGTGVSVTRSGDNIILNMPNNVTFDSSSATLKPAGANTLTGVAMVLKEYPKTAVNVVGYTDSTGSHDLNMRLSQQRADSVASSLITQGVDASRIRTSGMGPANPIASNSTAEGKAQNRRVEITLSPLQ
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 82-220aa
Protein length: Partial
MW: 18.6 kDa
Alternative Name(s):
Relevance:
Reference: McClelland M., Porwollik S., Desai P., Cheng P., Wollam A., Pepin K., Palsikar V.B., Fulton L., Fulton R., Delehaunty K., Fronick C., Godfrey J., Waligorski J., Appelbaum E., Tomlinson C., Warren W., Sodergren E., Weinstock G., Wilson R.K.Submitted (APR-2013)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Salmonella enterica OmpA family protein(A673_03341),partial
- Regular price
- €514,95 EUR
- Sale price
- €514,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Salmonella typhimurium Protein PrgJ(PrgJ)
- Regular price
- €748,95 EUR
- Sale price
- €748,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Salmonella typhimurium Protein prgI(prgI)
- Regular price
- €748,95 EUR
- Sale price
- €748,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Salmonella typhimurium Invasion protein iagB(iagB)
- Regular price
- €748,95 EUR
- Sale price
- €748,95 EUR
- Regular price
-
- Unit price
- per
Sold out