Recombinant Rhesus cytomegalovirus Envelope glycoprotein B(gB),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Rhesus cytomegalovirus Envelope glycoprotein B(gB),partial

CSB-EP309330RKC
Regular price
€675,95 EUR
Sale price
€675,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20171018

Research areas: Others

Target / Protein: gB

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Rhesus cytomegalovirus (strain 68-1) (RhCMV)

Delivery time: 3-7 business days

Uniprot ID: P89053

AA Sequence: MRQKRAYEKPFEHFFPYVVPPTTVKEAPPSYEQSQYENIKEKAASATKEFSLEEAYQMLLALQKLDQEKRRKAEADDEDFASNGQSAGFLDRLRNRRRGGYQKIQNEYEV

Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 745-854aa

Protein length: Partial

MW: 18.0 kDa

Alternative Name(s):

Relevance: Envelope glycoprotein that forms spikes at the surface of virion envelope. Essential for the initial attachment to heparan sulfate moities of the host cell surface proteoglycans. Involved in fusion of viral and cellular membranes leading to virus entry into the host cell. Following initial binding to its host receptors, membrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH/gL. May be involved in the fusion between the virion envelope and the outer nuclear membrane during virion egress.

Reference: "Identification of the gene coding for rhesus cytomegalovirus glycoprotein B and immunological analysis of the protein." Kropff B., Mach M. J. Gen. Virol. 78:1999-2007(1997)

Purity: Greater than 85% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share