
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Others
Uniprot ID: Q9QUL6
Gene Names: Nsf
Organism: Rattus norvegicus (Rat)
AA Sequence: QAARCPTDELSLSNCAVVNEKDYQSGQHVMVRTSPNHKYIFTLRTHPSVVPGCIAFSLPQRKWAGLSIGQDIEVALYSFDKAKQCIGTMTIEIDFLQKKNIDSNPYDTDKMAAEFIQQFNHQAFSVGQQLVFSFNDKLFGLLVKDIEAMDPSILKGEPASGKRQKIEVGLVVGNSQVAFEKAENSSLNLIGKAKTKENRQSII
Expression Region: 7-209aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 26.5 kDa
Alternative Name(s): N-ethylmaleimide-sensitive fusion protein ;NEM-sensitive fusion proteinVesicular-fusion protein NSF
Relevance: Required for vesicle-mediated transport. Catalyzes the fusion of transport vesicles within the Golgi cisternae. Is also required for transport from the endoplasmic reticulum to the Golgi stack. Ses to function as a fusion protein required for the delivery of cargo proteins to all compartments of the Golgi stack independent of vesicle origin. Interaction with AMPAR subunit GRIA2 leads to influence GRIA2 mbrane cycling.
Reference: Plk2 attachment to NSF induces homeostatic removal of GluA2 during chronic overexcitation.Evers D.M., Matta J.A., Hoe H.S., Zarkowsky D., Lee S.H., Isaac J.T., Pak D.T.Nat. Neurosci. 13:1199-1207(2010)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Golgi membrane protein 1(Golm1)
- Regular price
- €638,95 EUR
- Sale price
- €638,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Sortilin(Sort1),partial
- Regular price
- €636,95 EUR
- Sale price
- €636,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Golgi membrane protein 1(GOLM1),partial
- Regular price
- €498,95 EUR
- Sale price
- €498,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rat Sortilin(Sort1),partial
- Regular price
- €638,95 EUR
- Sale price
- €638,95 EUR
- Regular price
-
- Unit price
- per
Sold out