Recombinant Rat FAD-linked sulfhydryl oxidase ALR(Gfer)

Recombinant Rat FAD-linked sulfhydryl oxidase ALR(Gfer)

CSB-EP733907RA
Regular price
€638,95 EUR
Sale price
€638,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Signal Transduction

Target / Protein: Gfer

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Rattus norvegicus (Rat)

Delivery time: 3-7 business days

Uniprot ID: Q63042

AA Sequence: MAAPSEPAGFPRGSRFSFLPGGAHSEMTDDLVTDARGRGARHRKDNAPAAAPAPKGLEHGKRPCRACVDFKSWMRTQQKRDIKFREDCPQDREELGRNTWAFLHTLAAYYPDMPTPEQQQDMAQFIHIFSKFYPCEECAEDIRKRIDRSQPDTSTRVSFSQWLCRLHNEVNRKLGKPDFDCSRVDERWRDGWKDGSCD

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 1-198aa

Protein length: Full Length

MW: 38.8 kDa

Alternative Name(s): Augmenter of liver regeneration

Relevance: FAD-dependent sulfhydryl oxidase that regenerates the redox-active disulfide bonds in CHCHD4/MIA40, a chaperone essential for disulfide bond formation and protein folding in the mitochondrial intermembrane space. The reduced form of CHCHD4/MIA40 forms a transient intermolecular disulfide bridge with GFER/ERV1, resulting in regeneration of the essential disulfide bonds in CHCHD4/MIA40, while GFER/ERV1 becomes re-oxidized by donating electrons to cytochrome c or molecular oxygen. May have a function in liver regeneration and spermatogenesis

Reference: "The crystal structure of augmenter of liver regeneration: a mammalian FAD-dependent sulfhydryl oxidase." Wu C.-K., Dailey T.A., Dailey H.A., Wang B.-C., Rose J.P. Protein Sci. 12:1109-1118(2003)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Rat FAD-linked sulfhydryl oxidase ALR(Gfer)
    Regular price
    €638,95 EUR
    Sale price
    €638,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Mitochondrial intermembrane space import and assembly protein 40(CHCHD4)
    Regular price
    €499,95 EUR
    Sale price
    €499,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Protein disulfide-isomerase(P4HB)
    Regular price
    €499,95 EUR
    Sale price
    €499,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Protein disulfide-isomerase(P4hb)
    Regular price
    €557,95 EUR
    Sale price
    €557,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share