Recombinant Puccinia triticina Uncharacterized protein(PTTG_03405)

Recombinant Puccinia triticina Uncharacterized protein(PTTG_03405)

CSB-YP3750GPC
Regular price
€825,95 EUR
Sale price
€825,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Others

Uniprot ID:A0A180GV39

Gene Names:PTTG_03405

Organism:Puccinia triticina (isolate 1-1 / race 1 (BBBD)) (Brown leaf rust fungus)

AA Sequence:DAPASSTAATNAKTASAARAAAPGGKQPNLKPMNCTQAFLPFSEADVAALSSNDTKAAASGNYSTIPTEAACKGPAGSIDGLCDIGSCGNHPVCNTCVELIITGPNTTKTGTTTTPQVTCTNNYFFGNSTDPIKNVCTDGNDKTYTCTGGCVSYTSCQMCVSVDDPALQGP

Expression Region:19-189aa

Sequence Info:Full Length of Mature Protein

Source:Yeast

Tag Info:C-terminal 6xHis-tagged

MW:18.7 kDa

Alternative Name(s):Uncharacterized protein

Relevance:

Reference:

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:3-7 business days

You may also like

  • Recombinant Nc-DigChim-324430,partial
    Regular price
    €1.421,95 EUR
    Sale price
    €1.421,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Glycine max FT-like protein(FTL3)
    Regular price
    €736,95 EUR
    Sale price
    €736,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Enterobacteria phage T4 Recombination protein uvsY(uvsY),Biotinylated
    Regular price
    €919,95 EUR
    Sale price
    €919,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Sheep Serum amyloid A protein(SAA1)
    Regular price
    €469,95 EUR
    Sale price
    €469,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share