>Several Other Sizes Are Also Available. Please Inquire. Default Size: 10ug
Updated Date: Stock Protein updated on 20171228
Research areas: Cancer
Target / Protein: TSPO
Biologically active: Not Tested
Expression system: in vitro E.coli expression system
Species of origin: Sus scrofa (Pig)
Delivery time: 3-7 business days
Uniprot ID: Q6UN27
AA Sequence: MAPPWLPAVGFTLVPSLGGFLSSRNVLGKGLHWYAGLQKPSWHPPHWTLAPIWGTLYSAMGYGSYMIWKELGGFSEEAVVPLGLYAGQLALNWAWPPLFFGARQMGWALVDLVLTGGVAAATAVAWYQVSPLAARLLYPYLAWLAFAATLNYCVWRDNQGRRGGRRPSE
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 1-169aa
Protein length: Full Length
MW: 38.6 kDa
Alternative Name(s): Peripheral-type benzodiazepine receptor
Relevance: Promotes the transport of cholesterol across mitochondrial membranes and may play a role in lipid metabolism, but its precise physiological role is controversial. It is apparently not required for steroid hormone biosynthesis. Can bind protoporphyrin IX and may play a role in the transport of porphyrins and heme. Was initially identified as peripheral-type benzodiazepine receptor; can also bind isoquinoline carboxamides
Reference: "Cloning, sequencing, and chromosomal localization of pig peripheral benzodiazepine receptor: three different forms produced by alternative splicing." Zhang K., Demeure O., Belliard A., Goujon J.M., Favreau F., Desurmont T., Mauco G., Barriere M., Carretier M., Milan D., Papadopoulos V., Hauet T. Mamm. Genome 17:1050-1062(2006)
Purity: Greater than 85% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.