
Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Cardiovascular
Uniprot ID:P15782
Gene Names:SFTPB
Organism:Sus scrofa (Pig)
AA Sequence:FPIPLPFCWLCRTLIKRIQAVVPKGVLLKAVAQVCHVVPLPVGGICQCLAERYIVICLNMLLDRTLPQLVCGLVLRCSS
Expression Region:1-79aa
Sequence Info:Full Length of Mature Protein
Source:Yeast
Tag Info:Tag-Free
MW:8.7 kDa
Alternative Name(s):Pulmonary surfactant-associated protein B(SP-B)(8 kDa protein)(Pulmonary surfactant-associated proteolipid SPL(Phe))
Relevance:Pulmonary surfactant-associated proteins promote alveolar stability by lowering the surface tension at the air-liquid interface in the peripheral air spaces. SP-B increases the collapse pressure of palmitic acid to nearly 70 millinewtons per meter.
Reference:"Low-molecular-mass surfactant protein type 1. The primary structure of a hydrophobic 8-kDa polypeptide with eight half-cystine residues." Curstedt T., Johansson J., Barros-Soederling J., Robertson B., Nilsson G., Westberg M., Joernvall H. Eur. J. Biochem. 172:521-525(1988)
Purity:Greater than 90% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
Lead Time Guidance:25-35 business days
You may also like
-
Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)
- Regular price
- €710,95 EUR
- Sale price
- €710,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)
- Regular price
- €451,95 EUR
- Sale price
- €451,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)
- Regular price
- €410,95 EUR
- Sale price
- €410,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Pulmonary surfactant-associated protein B(SFTPB)
- Regular price
- €575,95 EUR
- Sale price
- €575,95 EUR
- Regular price
-
- Unit price
- per
Sold out