Recombinant Pig Complement C5a anaphylatoxin(C5)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Pig Complement C5a anaphylatoxin(C5)

CSB-YP003995PI
Regular price
€857,95 EUR
Sale price
€857,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: C5

Biologically active: Not Tested

Expression system: Yeast

Species of origin: Sus scrofa (Pig)

Delivery time: 3-7 business days

Uniprot ID: P01032

AA Sequence: MLQKKIEEEAAKYKYAMLKKCCYDGAYRNDDETCEERAARIKIGPKCVKAFKDCCYIANQVRAEQSHKNIQLGR

Tag info: N-terminal 6xHis-tagged

Expression Region: 1-74aa

Protein length: Full Length

MW: 10.6 kDa

Alternative Name(s):

Relevance: Derived from proteolytic degradation of complent C5, C5 anaphylatoxin is a mediator of local inflammatory process. Binding to the receptor C5AR1 induces a variety of responses including intracellular calcium release, contraction of smooth muscle, increased vascular permeability, and histamine release from mast cells and basophilic leukocytes. C5a is also a potent chokine which stimulates the locomotion of polymorphonuclear leukocytes and directs their migration toward sites of inflammation.

Reference: Three-dimensional structure of porcine C5adesArg from 1H nuclear magnetic resonance data.Williamson M.P., Madison V.S.Biochemistry 29:2895-2905(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share