Recombinant Phleum pRatense Pollen allergen Phl p 5b

Recombinant Phleum pRatense Pollen allergen Phl p 5b

CSB-EP671435EUQ
Regular price
€749,95 EUR
Sale price
€749,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Others

Target / Protein:

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Phleum pratense (Common timothy)

Delivery time: 3-7 business days

Uniprot ID: Q40963

AA Sequence: ADAGYAPATPAAAGAAAGKATTEEQKLIEDINVGFKAAVAAAASVPAADKFKTFEAAFTSSSKAAAAKAPGLVPKLDAAYSVAYKAAVGATPEAKFDSFVASLTEALRVIAGALEVHAVKPVTEEPGMAKIPAGELQIIDKIDAAFKVAATAAATAPADDKFTVFEAAFNKAIKESTGGAYDTYKCIPSLEAAVKQAYAATVAAAPQVKYAVFEAALTKAITAMSEVQKVSQPATGAATVAAGAATTAAGAASGAATVAAGGYKV

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-284aa

Protein length: Full Length

MW: 42.1 kDa

Alternative Name(s): Allergen Phl p Vb Allergen: Phl p 5b

Relevance: Has ribonuclease activity. May be involved in host-pathogen interactions.

Reference: "Major allergen Phl p Vb in timothy grass is a novel pollen RNase."Bufe A., Schramm G., Keown M.B., Schlaak M., Becker W.M.FEBS Lett. 363:6-12(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Phleum pRatense Pollen allergen Phl p 5b
    Regular price
    €749,95 EUR
    Sale price
    €749,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Phleum pratense Pollen allergen Phl p 5a
    Regular price
    €637,95 EUR
    Sale price
    €637,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Phleum pratense Pollen allergen Phl p 5a
    Regular price
    €749,95 EUR
    Sale price
    €749,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Phleum pratense Pollen allergen Phl p 5a
    Regular price
    €749,95 EUR
    Sale price
    €749,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share