
Size:50 ug. Other sizes are also available.
Product Type:Recombinant Protein
Species:Mycoplasma pneumoniae (strain ATCC 29342 / M129)
Uniprot NO.:P75439
Tag Info:The tag type will be determined during production process.
Storage Buffer:Tris-based buffer,50% glycerol, optimized for this protein
Storage:Store at -20℃, for extended storage, conserve at -20℃ or -80℃.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
AA Sequence:MQVKVIDENSNTTAVLNCAKAKTRALAWLCDTVLLAILLAIIYGISSIFIKEQSSVFLIM TVSQAVLWLTYFVILPGLWKGKTLFRALLGLSLLIFKKRFWNLLVHELFLWVWYSVIFLA LAIYFFVNRDDPKILQAFFDNQNSNLSWIFVKILLSVISVLQLVFVVYFCFSSQKQALQD LLSKSFMVQKAIKVKDCKSELKSTNTIKTHSDLPGDIDLEQLGD
Protein Names:Recommended name: Uncharacterized protein MG243 homolog
Gene Names:Ordered Locus Names:MPN_339 ORF Names:H91_orf224, MP497
Expression Region:1-224
Sequence Info:full length protein
You may also like
-
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG133 homolog (MPN_274)
- Regular price
- €1.134,95 EUR
- Sale price
- €1.134,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG323.1 homolog (MPN_469)
- Regular price
- €1.117,95 EUR
- Sale price
- €1.117,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG452 homolog (MPN_666)
- Regular price
- €1.123,95 EUR
- Sale price
- €1.123,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycoplasma pneumoniae Uncharacterized protein MG256 homolog (MPN_359)
- Regular price
- €1.128,95 EUR
- Sale price
- €1.128,95 EUR
- Regular price
-
- Unit price
- per
Sold out