
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: mpt51
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)
Delivery time: 3-7 business days
Uniprot ID: P9WQN6
AA Sequence: AEPTAKAAPYENLMVPSPSMGRDIPVAFLAGGPHAVYLLDAFNAGPDVSNWVTAGNAMNTLAGKGISVVAPAGGAYSMYTNWEQDGSKQWDTFLSAELPDWLAANRGLAPGGHAAVGAAQGGYGAMALAAFHPDRFGFAGSMSGFLYPSNTTTNGAIAAGMQQFGGVDTNGMWGAPQLGRWKWHDPWVHASLLAQNNTRVWVWSPTNPGASDPAAMIGQAAEAMGNSRMFYNQYRSVGGHNGHFDFPASGDNGWGSWAPQLGAMSGDIVGAIR
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 27-299aa
Protein length: Full Length of Mature Protein
MW: 44.5 kDa
Alternative Name(s):
Relevance: May have a role in host tissue attachment, whereby ligands may include the serum protein fibronectin and small sugars.
Reference: "Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains."Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M.J. Bacteriol. 184:5479-5490(2002)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mycobacterium tuberculosis MPT51-MPB51 antigen(mpt51)
- Regular price
- €752,95 EUR
- Sale price
- €752,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)
- Regular price
- €825,95 EUR
- Sale price
- €825,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycobacterium tuberculosis Putative amidase AmiB2(amiB2)
- Regular price
- €752,95 EUR
- Sale price
- €752,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mycobacterium tuberculosis Mycothione reductase(mtr)
- Regular price
- €752,95 EUR
- Sale price
- €752,95 EUR
- Regular price
-
- Unit price
- per
Sold out