Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12(mtb12)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mycobacterium tuberculosis Low molecular weight antigen MTB12(mtb12)

CSB-YP363739MVZ
Regular price
€823,95 EUR
Sale price
€823,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P9WIN6

Gene Names: mtb12

Organism: Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

AA Sequence: DPASAPDVPTAAQLTSLLNSLADPNVSFANKGSLVEGGIGGTEARIADHKLKKAAEHGDLPLSFSVTNIQPAAAGSATADVSVSGPKLSSPVTQNVTFVNQGGWMLSRASAMELLQAAGN

Expression Region: 49-168aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 14.1 kDa

Alternative Name(s): CFP-2 Low molecular weight protein antigen 2

Relevance: May play a role in the development of protective immune responses.

Reference: "Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains."Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M.J. Bacteriol. 184:5479-5490(2002)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Mycobacterium tuberculosis Immunogenic protein MPT63(mpt63)
    Regular price
    €750,95 EUR
    Sale price
    €750,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)
    Regular price
    €823,95 EUR
    Sale price
    €823,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)
    Regular price
    €412,95 EUR
    Sale price
    €412,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mycobacterium tuberculosis Immunogenic protein MPT64(mpt64)
    Regular price
    €453,95 EUR
    Sale price
    €453,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share