Recombinant Mouse Serum amyloid A-1 protein(Saa1)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Serum amyloid A-1 protein(Saa1)

CSB-EP020656MO
Regular price
€637,95 EUR
Sale price
€637,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: Saa1

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Mus musculus (Mouse)

Delivery time: 3-7 business days

Uniprot ID: P05366

AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY

Tag info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-122aa

Protein length: Full Length of Mature Protein

MW: 27.8 kDa

Alternative Name(s):

Relevance: Major acute phase protein

Reference: "Complete primary structures of two major murine serum amyloid A proteins deduced from cDNA sequences."Yamamoto K., Migita S.Proc. Natl. Acad. Sci. U.S.A. 82:2915-2919(1985)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Mouse Serum amyloid A-1 protein(Saa1)
    Regular price
    €637,95 EUR
    Sale price
    €637,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Serum amyloid A-3 protein(Saa3)
    Regular price
    €635,95 EUR
    Sale price
    €635,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Mouse Serum amyloid A-2 protein(Saa2)
    Regular price
    €728,95 EUR
    Sale price
    €728,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Rabbit Serum amyloid A-1 protein(SAA1)
    Regular price
    €637,95 EUR
    Sale price
    €637,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share