
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170725
Research areas: Others
Target / Protein: Saa1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: P05366
AA Sequence: GFFSFVHEAFQGAGDMWRAYTDMKEANWKNSDKYFHARGNYDAAQRGPGGVWAAEKISDGREAFQEFFGRGHEDTIADQEANRHGRSGKDPNYYRPPGLPDKY
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 20-122aa
Protein length: Full Length of Mature Protein
MW: 27.8 kDa
Alternative Name(s):
Relevance: Major acute phase protein
Reference: "Complete primary structures of two major murine serum amyloid A proteins deduced from cDNA sequences."Yamamoto K., Migita S.Proc. Natl. Acad. Sci. U.S.A. 82:2915-2919(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Serum amyloid A-1 protein(Saa1)
- Regular price
- €637,95 EUR
- Sale price
- €637,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Serum amyloid A-3 protein(Saa3)
- Regular price
- €635,95 EUR
- Sale price
- €635,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Serum amyloid A-2 protein(Saa2)
- Regular price
- €728,95 EUR
- Sale price
- €728,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Rabbit Serum amyloid A-1 protein(SAA1)
- Regular price
- €637,95 EUR
- Sale price
- €637,95 EUR
- Regular price
-
- Unit price
- per
Sold out