Recombinant Mouse Lymphocyte antigen 6E(Ly6e)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Mouse Lymphocyte antigen 6E(Ly6e)

CSB-EP717533MOb1
Regular price
€617,95 EUR
Sale price
€617,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Immunology

Uniprot ID: Q64253

Gene Names: Ly6e

Organism: Mus musculus (Mouse)

AA Sequence: LMCFSCTDQKNNINCLWPVSCQEKDHYCITLSAAAGFGNVNLGYTLNKGCSPICPSENVNLNLGVASVNSYCCQSSFCNFSA

Expression Region: 21-102aa

Sequence Info: Full Length of Mature Protein

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

MW: 13.8 kDa

Alternative Name(s): Stem cell antigen 2 Thymic shared antigen 1

Relevance: Involved in T-cell development.

Reference: "Genomic organization and expression of mouse thymic shared antigen-1 (TSA-1): evidence for a processed pseudogene." Classon B.J., Coverdale L. Immunogenetics 44:222-226(1996)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share