
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: Q80ZF2
Gene Names: Ifne
Organism: Mus musculus (Mouse)
AA Sequence: LEPKRIPFQLWMNRESLQLLKPLPSSSVQQCLAHRKNFLLPQQPVSPHQYQEGQVLAVVHEILQQIFTLLQTHGTMGIWEENHIEKVLAALHRQLEYVESLGGLNAAQKSGGSSAQNLRLQIKAYFRRIHDYLENQRYSSCAWIIVQTEIHRCMFFVFRFTTWLSRQDPDP
Expression Region: 22-192aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 22 kDa
Alternative Name(s): Interferon epsilon-1Interferon tau-1
Relevance: Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the fale reproductive tract. Directly mediates protection against viral, including HSV-2, and bacterial, including Chlamydia muridarum, genital infections.
Reference: Characterization of the type I interferon locus and identification of novel genes.Hardy M.P., Owczarek C.M., Jermiin L.S., Ejdebaeck M., Hertzog P.J.Genomics 84:331-345(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Interferon epsilon(Ifne)
- Regular price
- €638,95 EUR
- Sale price
- €638,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interferon epsilon(IFNE)
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interferon epsilon(IFNE)
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Interferon alpha-beta receptor 2(Ifnar2),partial
- Regular price
- €636,95 EUR
- Sale price
- €636,95 EUR
- Regular price
-
- Unit price
- per
Sold out