
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Signal Transduction
Target / Protein: Fgf15
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Mus musculus (Mouse)
Delivery time: 3-7 business days
Uniprot ID: O35622
AA Sequence: RPLAQQSQSVSDEDPLFLYGWGKITRLQYLYSAGPYVSNCFLRIRSDGSVDCEEDQNERNLLEFRAVALKTIAIKDVSSVRYLCMSADGKIYGLIRYSEEDCTFREEMDCLGYNQYRSMKHHLHIIFIQAKPREQLQDQKPSNFIPVFHRSFFETGDQLRSKMFSLPLESDSMDPFRMVEDVDHLVKSPSFQK
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 26-218aa
Protein length: Full Length of Mature Protein
MW: 38.5 kDa
Alternative Name(s): Short name:FGF-15
Relevance: Involved in the suppression of bile acid biosynthesis through down-regulation of CYP7A1 expression.
Reference: "The transcriptional landscape of the mammalian genome."Carninci P., Kasukawa T., Katayama S., Gough J., Frith M.C., Maeda N., Oyama R., Ravasi T., Lenhard B., Wells C., Kodzius R., Shimokawa K., Bajic V.B., Brenner S.E., Batalov S., Forrest A.R., Zavolan M., Davis M.J. Hayashizaki Y.Science 309:1559-1563(2005)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Mouse Fibroblast growth factor 15(Fgf15)
- Regular price
- €640,95 EUR
- Sale price
- €640,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Fibroblast growth factor 21(Fgf21)
- Regular price
- €640,95 EUR
- Sale price
- €640,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Fibroblast growth factor 14(FGF14)
- Regular price
- €500,95 EUR
- Sale price
- €500,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Fibroblast growth factor 21(Fgf21)
- Regular price
- €640,95 EUR
- Sale price
- €640,95 EUR
- Regular price
-
- Unit price
- per
Sold out