Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Others
Uniprot ID: P05208
Gene Names: Cela2a
Organism: Mus musculus (Mouse)
AA Sequence: VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN
Expression Region: 31-271aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 27.7 kDa
Alternative Name(s): Elastase-2 Elastase-2A
Relevance: Acts upon elastin.
Reference: "Wnk1 kinase deficiency lowers blood pressure in mice: a gene-trap screen to identify potential targets for therapeutic intervention." Zambrowicz B.P., Abuin A., Ramirez-Solis R., Richter L.J., Piggott J., BeltrandelRio H., Buxton E.C., Edwards J., Finch R.A., Friddle C.J., Gupta A., Hansen G., Hu Y., Huang W., Jaing C., Key B.W. Jr., Kipp P., Kohlhauff B. Sands A.T.Proc. Natl. Acad. Sci. U.S.A. 100:14109-14114(2003)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.