Size:100ug. Other sizes are also available. For further information, please contact us.
Research Areas:Cancer
Uniprot ID:Q769J6
Gene Names:Adamts13
Organism:Mus musculus (Mouse)
AA Sequence:WTPLVGLCSISCGRGLKELYFLCMDSVLKMPVQEELCGLASKPPSRWEVCRARPCPARWETQVLAPCPVTCGGGRVPLSVRCVQLDRGHPISVPHSKCSPVPKPGSFEDCSPEPCPARWKVLSLGPCSASCGLGTATQMVACMQLDQGHDNEVNETFCKALVRPQASVPCLIADCAFRWHISAWTECSVSCGDGIQRRHDTCLGPQAQVPVPANFCQHLPKPMTVRGCWAGPCA
Expression Region:904-1137aa
Sequence Info:Partial
Source:E.coli
Tag Info:N-terminal 10xHis-tagged and C-terminal Myc-tagged
MW:32.7 kDa
Alternative Name(s):von Willebrand factor-cleaving protease (vWF-CP) (vWF-cleaving protease) (ADAM-TS 13) (ADAM-TS13) (ADAMTS-13) (Gm710)
Relevance:Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation.
Reference:"The combined roles of ADAMTS13 and VWF in murine models of TTP, endotoxemia, and thrombosis." Chauhan A.K., Walsh M.T., Zhu G., Ginsburg D., Wagner D.D., Motto D.G. Blood 111:3452-3457(2008)
Purity:Greater than 85% as determined by SDS-PAGE.
Form:Liquid or Lyophilized powder
Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:Cleaves the vWF multimers in plasma into smaller forms thereby controlling vWF-mediated platelet thrombus formation.
Involvement in disease:
Subcellular Location:Secreted
Protein Families:
Tissue Specificity:Plasma. Expression is consistently high in liver, medium in lung and spleen, low in skeletal muscle and undetectable in heart, brain, kidney and testis.
Paythway:
HGNC Database Link:
UniGene Database Link:https://www.ncbi.nlm.nih.gov/UniGene/clust.cgi?ORG=Mm&CID=330084
KEGG Database Link:https://www.genome.jp/dbget-bin/www_bget?mmu:279028
STRING Database Link:https://string-db.org/network/10090.ENSMUSP00000099955
OMIM Database Link:
Lead Time Guidance:3-7 business days