>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Allergen
Target / Protein: MALD1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Malus domestica (Apple) (Pyrus malus)
Delivery time: 3-7 business days
Uniprot ID: P43211
AA Sequence: GVYTFENEFTSEIPPSRLFKAFVLDADNLIPKIAPQAIKQAEILEGNGGPGTIKKITFGEGSQYGYVKHRIDSIDEASYSYSYTLIEGDALTDTIEKISYETKLVACGSGSTIKSISHYHTKGNIEIKEEHVKVGKEKAHGLFKLIESYLKDHPDAYN
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 2-159aa
Protein length: Full Length
MW: 33.5 kDa
Alternative Name(s): Allergen Mal d I Allergen: Mal d 1
Relevance:
Reference: "Characterization of the 18-kDa apple allergen by two-dimensional immunoblotting and microsequencing."Vieths S., Schoening B., Petersen A.Int. Arch. Allergy Immunol. 104:399-404(1994)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.