Recombinant Macaca mulatta Uncharacterized protein(IL17A)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Macaca mulatta Uncharacterized protein(IL17A)

CSB-EP011597MOV
Regular price
€781,95 EUR
Sale price
€781,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170725

Research areas: Others

Target / Protein: IL17A

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Macaca mulatta (Rhesus macaque)

Delivery time: 3-7 business days

Uniprot ID: F6T3G5

AA Sequence: GIAIPRNPGCPNSEDKTFPRTVMVNLNIHNRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCVNADGNVDYHMNSVPIQQEILVLRREPRHCPNSFRLEKILVSVGCTCVTPIVHHVA

Tag info: N-terminal GST-tagged

Expression Region: 24-155aa

Protein length: Full Length of Mature Protein

MW: 42.1 kDa

Alternative Name(s):

Relevance:

Reference: Genome sequencing and comparison of two nonhuman primate animal models, the cynomolgus and Chinese rhesus macaques.Yan G., Zhang G., Fang X., Zhang Y., Li C., Ling F., Cooper D.N., Li Q., Li Y., van Gool A.J., Du H., Chen J., Chen R., Zhang P., Huang Z., Thompson J.R., Meng Y., Bai Y. , Wang J., Zhuo M., Wang T., Huang Y., Wei L., Li J., Wang Z., Hu H., Yang P., Le L., Stenson P.D., Li B., Liu X., Ball E.V., An N., Huang Q., Zhang Y., Fan W., Zhang X., Li Y., Wang W., Katze M.G., Su B., Nielsen R., Yang H., Wang J., Wang X., Wang J.Nat. Biotechnol. 29:1019-1023(2011)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share