Recombinant Macaca mulatta Interleukin-10(IL10)

CSB-BP011580MOW

Size: 20ug. Other sizes are also available. Please Inquire.

In Stock: Yes

Lead time: 3-7 working days

Research Topic: Immunology

Uniprot ID: P51496

Gene Names: IL10

Organism: Macaca mulatta (Rhesus macaque)

AA Sequence: SPGQGTQSENSCTRFPGNLPHMLRDLRDAFSRVKTFFQMKDQLDNILLKESLLEDFKGYLGCQALSEMIQFYLEEVMPQAENHDPDIKEHVNSLGENLKTLRLRLRRCHRFLPCENKSKAVEQVKNAFSKLQEKGVYKAMSEFDIFINYIEAYMTMKIQN

Expression Region: 19-178aa

Sequence Info: Full Length of Mature Protein

Source: Baculovirus

Tag Info: N-terminal 10xHis-tagged and C-terminal myc-tagged

MW: 22.7 kDa

Alternative Name(s): Cytokine synthesis inhibitory factor

Relevance: Inhibits the synthesis of a number of cytokines, including IFN-gamma, IL-2, IL-3, TNF and GM-CSF produced by activated macrophages and by helper T-cells.

Reference: "Comparative sequence analysis of cytokine genes from human and nonhuman primates." Villinger F.J., Brar S.S., Mayne A.E., Chikkala N., Ansari A.A. J. Immunol. 155:3946-3954(1995)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.