Recombinant Macaca fascicularis Tumor necrosis factor ligand superfamily member 6(FASLG),partial

Recombinant Macaca fascicularis Tumor necrosis factor ligand superfamily member 6(FASLG),partial

CSB-CF008434MOV2
Regular price
€882,95 EUR
Sale price
€882,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:20ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cell Biology

Uniprot ID:P63308

Gene Names:FASLG

Organism:Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

AA Sequence:QLFHLQKELAELRESTSQKHTASSLEKQIGHPSPPPEKKEQRKVAHLTGKPNSRSMPLEWEDTYGIVLLSGVKYKKGGLVINETGLYFVYSKVYFRGQSCTNLPLSHKVY

Expression Region:102-211aa

Sequence Info:Partial

Source:in vitro E.coli expression system

Tag Info:N-terminal 6xHis-tagged

MW:18.5 kDa

Alternative Name(s):CD95 ligand (CD95-L) (Fas antigen ligand) (Fas ligand) (FasL) (CD_antigen: CD178) (CD95L) (FASL) (TNFSF6)

Relevance:Cytokine that binds to TNFRSF6/FAS, a receptor that transduces the apoptotic signal into cells. Involved in cytotoxic T-cell-mediated apoptosis, natural killer cell-mediated apoptosis and in T-cell development. Initiates fratricidal/suicidal activation-induced cell death in antigen-activated T-cells contributing to the termination of immune responses. TNFRSF6/FAS-mediated apoptosis has also a role in the induction of peripheral tolerance. Binds to TNFRSF6B/DcR3, a decoy receptor that blocks apoptosis.Tumor necrosis factor ligand superfamily member 6, soluble form: Induces FAS-mediated activation of NF-kappa-B, initiating non-apoptotic signaling pathways. Can induce apoptosis but does not appear to be essential for this process.FasL intracellular domain: Cytoplasmic form induces gene transcription inhibition.

Reference:"Molecular cloning, functional characterization, and enzyme-linked immunosorbent assay of cynomolgus monkey Fas ligand." Kirii Y., Inoue T., Yoshino K., Kayagaki N., Yagita H., Okumura K., Shibata H., Yoshikawa Y., Terao K. J. Immunol. Methods 278:201-209(2003)

Purity:Greater than 85% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:18-23 business days

Your list is ready to share