Recombinant Macaca fascicularis Alpha-synuclein(SNCA)

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Macaca fascicularis Alpha-synuclein(SNCA)

CSB-YP021912MOV
Regular price
€862,95 EUR
Sale price
€862,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 22-32 working days

Research Topic: Others

Uniprot ID: P61142

Gene Names: SNCA

Organism: Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

AA Sequence: MDVFMKGLSKAKEGVVAAAEKTKQGVAEAAGKTKEGVLYVGSKTKEGVVHGVATVAEKTKEQVTNVGGAVVTGVTAVAQKTVEGAGSIAAATGFIKKDQLGKNEEGAPQEGILQDMPVDPDNEAYEMPSEEGYQDYEPEA

Expression Region: 1-140aa

Sequence Info: Full Length

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

MW: 16.5 kDa

Alternative Name(s):

Relevance: May be involved in the regulation of dopamine release and transport.

Reference: "Alpha-synuclein A53T substitution associated with Parkinson disease also marks the divergence of Old World and New World primates." Hamilton B.A.Genomics 83:739-742(2004)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share