Recombinant Lactococcus lactis Lipoprotein signal peptidase(lspA)

Recombinant Lactococcus lactis Lipoprotein signal peptidase(lspA)

CSB-CF2619Ba
Regular price
€1.095,95 EUR
Sale price
€1.095,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 10ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 15-20 working days

Research Topic: Others

Uniprot ID: A0A089ZE57

Gene Names: lspA

Organism: Lactococcus lactis

AA Sequence: MKKLLSLVIIVVGIVADQIFKNWIVANIQLGDTEKIWPNVLSLTYIKNDGAAWSSFSGQQWFFLVLTPIVLVVALWFLWKKMAQNWYFIGLTLIIAGALGNFIDRIRQGFVVDMFQTEFINFPIFNIADILLSVGFVLLFIAILTDKETK

Expression Region: 1-150aa

Sequence Info: Full Length

Source: in vitro E.coli expression system

Tag Info: C-terminal 6xHis-tagged

MW: 19.9 kDa

Alternative Name(s): Prolipoprotein signal peptidase Signal peptidase II

Relevance: This protein specifically catalyzes the removal of signal peptides from prolipoproteins.

Reference:

Purity: Greater than 85% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share