Size: 10ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 15-20 working days
Research Topic: Others
Uniprot ID: A0A089ZE57
Gene Names: lspA
Organism: Lactococcus lactis
AA Sequence: MKKLLSLVIIVVGIVADQIFKNWIVANIQLGDTEKIWPNVLSLTYIKNDGAAWSSFSGQQWFFLVLTPIVLVVALWFLWKKMAQNWYFIGLTLIIAGALGNFIDRIRQGFVVDMFQTEFINFPIFNIADILLSVGFVLLFIAILTDKETK
Expression Region: 1-150aa
Sequence Info: Full Length
Source: in vitro E.coli expression system
Tag Info: C-terminal 6xHis-tagged
MW: 19.9 kDa
Alternative Name(s): Prolipoprotein signal peptidase Signal peptidase II
Relevance: This protein specifically catalyzes the removal of signal peptides from prolipoproteins.
Reference:
Purity: Greater than 85% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.