Recombinant Human Uncharacterized protein C4orf3(C4orf3),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Uncharacterized protein C4orf3(C4orf3),partial

CSB-EP823892HU
Regular price
€528,95 EUR
Sale price
€528,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cell Biology

Uniprot ID: Q8WVX3

Gene Names: C4orf3

Organism: Homo sapiens (Human)

AA Sequence: MEVDAPGVDGRDGLRERRGFSEGGRQNFDVRPQSGANGLPKHSY

Expression Region: 1-44aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 20.8 kDa

Alternative Name(s): Hepatitis C virus F protein-transactivated protein 1 ;HCV F-transactivated protein 1

Relevance:

Reference: Screening and cloning target genes transactivated by hepatitis C virus F protein using suppression subtractive hybridization technique.Guo J., Cheng J., Ji D., Zhao L.F., Gao X.S., Liu Y., Wu S.H.Zhonghua Gan Zang Bing Za Zhi 13:660-663(2005)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share