
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Cancer
Uniprot NO.:Q02223
Uniprot Entry Name:
Gene Names:Tnfrsf17
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:1-54aa
Sequence:MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA
Protein Description:Partial
Tag Info:C-terminal hFc-tagged
Mol. Weight:34.8 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized BCMA at 2 ?g/ml can bind Anti-BCMA recombinant antibody, the EC50 of human BCMA protein is 1.912-2.488 ng/ml.
Purity:Greater than 90% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:B-cell maturation protein (CD_antigen: CD269)
Relevance:Receptor for TNFSF13B/BLyS/BAFF and TNFSF13/APRIL. Promotes B-cell survival and plays a role in the regulation of humoral immunity.
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Tumor necrosis factor receptor superfamily member 17 protein(TNFRSF17),partial (Active)
- Regular price
- €1.710,95 EUR
- Sale price
- €1.710,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Tumor necrosis factor receptor superfamily member 17(TNFRSF17),partial
- Regular price
- €450,95 EUR
- Sale price
- €450,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Tumor necrosis factor ligand superfamily member 9(TNFSF9),partial (Active)
- Regular price
- €323,95 EUR
- Sale price
- €323,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Tumor necrosis factor receptor superfamily member 9(TNFRSF9),partial (Active)
- Regular price
- €275,95 EUR
- Sale price
- €275,95 EUR
- Regular price
-
- Unit price
- per
Sold out