Recombinant Human Tumor necrosis factor ligand superfamily member 12(TNFSF12),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human Tumor necrosis factor ligand superfamily member 12(TNFSF12),partial

CSB-EP023987HU
Regular price
€499,95 EUR
Sale price
€499,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Cancer

Uniprot ID: O43508

Gene Names: TNFSF12

Organism: Homo sapiens (Human)

AA Sequence: SLGSRASLSAQEPAQEELVAEEDQDPSELNPQTEESQDPAPFLNRLVRPRRSAPKGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQ

Expression Region: 43-149aa

Sequence Info: Extracellular Domain

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 27.8 kDa

Alternative Name(s): APO3 ligandTNF-related weak inducer of apoptosis ;TWEAK

Relevance: Binds to FN14 and possibly also to TNRFSF12/APO3. Weak inducer of apoptosis in some cell types. Mediates NF-kappa-B activation. Promotes angiogenesis and the proliferation of endothelial cells. Also involved in induction of inflammatory cytokines. Promotes IL8 secretion.

Reference: Crystal structure of human TWEAK in complex with the Fab fragment of a neutralizing antibody reveals insights into receptor binding.Lammens A., Baehner M., Kohnert U., Niewoehner J., von Proff L., Schraeml M., Lammens K., Hopfner K.P.PLoS ONE 8:E62697-E62697(2013)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Tumor necrosis factor receptor superfamily member 11A(TNFRSF11A),partial
    Regular price
    €499,95 EUR
    Sale price
    €499,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • TNFSF12 Antibody - Cat. #: CSB-PA023987ESR1HU
    Regular price
    €303,95 EUR
    Sale price
    €303,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Tumor necrosis factor receptor superfamily member 3(LTBR),partial
    Regular price
    €499,95 EUR
    Sale price
    €499,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • TNFSF12 Antibody - Cat. #: CSB-PA023987LA01HU
    Regular price
    €303,95 EUR
    Sale price
    €303,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share