>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20171018
Research areas: Others
Target / Protein: SPRR2B
Biologically active: Not Tested
Expression system: Yeast
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P35325
AA Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQPKYPPKSK
Tag info: N-terminal 10xHis-tagged and C-terminal Myc-tagged
Expression Region: 1-72aa
Protein length: Full Length
MW: 12.0 kDa
Alternative Name(s):
Relevance: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
Reference: "Structural organization and regulation of the small proline-rich family of cornified envelope precursors suggest a role in adaptive barrier function." Cabral A., Voskamp P., Cleton-Jansen A.-M., South A., Nizetic D., Backendorf C. J. Biol. Chem. 276:19231-19237(2001)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.