
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Neuroscience
Uniprot NO.:O43157
Uniprot Entry Name:
Gene Names:PLXNB1
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:20-535aa
Sequence:LQPLPPTAFTPNGTYLQHLARDPTSGTLYLGATNFLFQLSPGLQLEATVSTGPVLDSRDCLPPVMPDECPQAQPTNNPNQLLLVSPGALVVCGSVHQGVCEQRRLGQLEQLLLRPERPGDTQYVAANDPAVSTVGLVAQGLAGEPLLFVGRGYTSRGVGGGIPPITTRALWPPDPQAAFSYEETAKLAVGRLSEYSHHFVSAFARGASAYFLFLRRDLQAQSRAFRAYVSRVCLRDQHYYSYVELPLACEGGRYGLIQAAAVATSREVAHGEVLFAAFSSAAPPTVGRPPSAAAGASGASALCAFPLDEVDRLANRTRDACYTREGRAEDGTEVAYIEYDVNSDCAQLPVDTLDAYPCGSDHTPSPMASRVPLEATPILEWPGIQLTAVAVTMEDGHTIAFLGDSQGQLHRVYLGPGSDGHPYSTQSIQQGSAVSRDLTFDGTFEHLYVMTQSTLLKVPVASCAQHLDCASCLAHRDPYCGWCVLLGRCSRRSECSRGQGPEQWLWSFQPELGCLQ
Protein Description:Partial
Tag Info:N-terminal mFc-tagged
Mol. Weight:83.2 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized human SEMA4D (CSB-MP835707HUd9) at 5 ?g/mL can bind human PLXNB1, the EC50 is 0.8179-1.357 ?g/mL.
Purity:Greater than 95% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:(Semaphorin receptor SEP)
Relevance:Receptor for SEMA4D (PubMed:19843518, PubMed:20877282, PubMed:21912513). Plays a role in GABAergic synapse development. Mediates SEMA4A- and SEMA4D-dependent inhibitory synapse development. Plays a role in RHOA activation and subsequent changes of the actin cytoskeleton (PubMed:12196628, PubMed:15210733). Plays a role in axon guidance, invasive growth and cell migration (PubMed:12198496).
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human Plexin-B1(PLXNB1),partial
- Regular price
- €740,95 EUR
- Sale price
- €740,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human 5'-nucleotidase(NT5E) (Active)
- Regular price
- €367,95 EUR
- Sale price
- €367,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Ephrin type-A receptor 3(EPHA3),partial (Active)
- Regular price
- €327,95 EUR
- Sale price
- €327,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human YTH domain-containing family protein 1(YTHDF1)
- Regular price
- €602,95 EUR
- Sale price
- €602,95 EUR
- Regular price
-
- Unit price
- per
Sold out