Recombinant Human NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial(NDUFV2),partial

CSB-RP053854h

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Transport

Uniprot ID: P19404

Gene Names: NDUFV2

Organism: Homo sapiens (Human)

AA Sequence: GGALFVHRDTPENNPDTPFDFTPENYKRIEAIVKNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYTMYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGACVNAPMVQINDNYYEDLTAKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKGPGFGVQAGL

Expression Region: 35-249aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal GST-tagged

MW: 50.6 kDa

Alternative Name(s): NADH-ubiquinone oxidoreductase 24KDA subunit

Relevance: Core subunit of the mitochondrial mbrane respiratory chain NADH dehydrogenase (Complex I) that is believed to belong to the minimal assbly required for catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone .

Reference: Mitochondrial c-Src regulates cell survival through phosphorylation of respiratory chain components.Ogura M., Yamaki J., Homma M.K., Homma Y.Biochem. J. 447:281-289(2012)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer，50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.