Recombinant Human N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase(AGA),partial

Customer Reviews

Be the first to write a review
0%
(0)
0%
(0)
0%
(0)
0%
(0)
0%
(0)

Recombinant Human N(4)-(beta-N-acetylglucosaminyl)-L-asparaginase(AGA),partial

CSB-EP001423HU(F1)-GB
Regular price
€528,95 EUR
Sale price
€528,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size: 200ug. Other sizes are also available. Please Inquire.

In Stock: No

Lead time: 10-20 working days

Research Topic: Signal Transduction

Uniprot ID: P20933

Gene Names: AGA

Organism: Homo sapiens (Human)

AA Sequence: TIGMVVIHKTGHIAAGTSTNGIKFKIHGRVGDSPIPGAGAYADDTAGAAAATGNGDILMRFLPSYQAVEYMRRGEDPTIACQKVISRIQKHFPEFFGAVICANVTGSYGAACNKLSTFTQFSFMVYNSEKNQPTEEKVDCI

Expression Region: 206-346aa

Sequence Info: Partial

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

MW: 31.1 kDa

Alternative Name(s): Aspartylglucosaminidase;Glycosylasparaginase;N4-(N-acetyl-beta-glucosaminyl)-L-asparagine amidase

Relevance: Cleaves the GlcNAc-Asn bond which joins oligosaccharides to the peptide of asparagine-linked glycoproteins.

Reference: Cloning and sequence analysis of a cDNA for human glycosylasparaginase. A single gene encodes the subunits of this lysosomal amidase.Fisher K.J., Tollersrud O.-K., Aronson N.N. Jr.FEBS Lett. 269:440-444(1990)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage Buffer: Tris-based buffer,50% glycerol

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Your list is ready to share