
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Epigenetics and Nuclear Signaling
Uniprot ID: P02795
Gene Names: MT2A
Organism: Homo sapiens (Human)
AA Sequence: MDPNCSCAAGDSCTCAGSCKCKECKCTSCKKSCCSCCPVGCAKCAQGCICKGASDKCSC
Expression Region: 1-59aa
Sequence Info: Partial
Source: E.coli
Tag Info: N-terminal GST-tagged
MW: 32.9 kDa
Alternative Name(s): Metallothionein-2AMetallothionein-II ;MT-II
Relevance: Metallothioneins have a high content of cysteine residues that bind various heavy metals; these proteins are transcriptionally regulated by both heavy metals and glucocorticoids.
Reference: Primary structure of human hepatic metallothionein.Kissling M.M., Kaegi J.H.R.FEBS Lett. 82:247-250(1977)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Metallothionein-2(MT2A),partial
- Regular price
- €557,95 EUR
- Sale price
- €557,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Metallothionein-1G(MT1G),partial
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Metallothionein-1F(MT1F),partial
- Regular price
- €557,95 EUR
- Sale price
- €557,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Metallothionein-1X protein(MT1X),partial
- Regular price
- €557,95 EUR
- Sale price
- €557,95 EUR
- Regular price
-
- Unit price
- per
Sold out