Recombinant Human Metalloproteinase inhibitor 2(TIMP2)

Recombinant Human Metalloproteinase inhibitor 2(TIMP2)

CSB-MP023561HU(A4)
Regular price
€1.129,95 EUR
Sale price
€1.129,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.

Size:100ug. Other sizes are also available. For further information, please contact us.

Research Areas:Cardiovascular

Uniprot ID:P16035

Gene Names:TIMP2

Organism:Homo sapiens (Human)

AA Sequence:CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Expression Region:27-220aa

Sequence Info:Full Length of Mature Protein

Source:Mammalian cell

Tag Info:C-terminal 6xHis-myc-tagged

MW:25.1 kDa

Alternative Name(s):CSC-21KTissue inhibitor of metalloproteinases 2;TIMP-2

Relevance:Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-8, MMP-9, MMP-10, MMP-13, MMP-14, MMP-15, MMP-16 and MMP-19.

Reference:Human 72-kilodalton type IV collagenase forms a complex with a tissue inhibitor of metalloproteases designated TIMP-2.Goldberg G.I., Marmer B.L., Grant G.A., Eisen A.Z., Wilhelm S., He C.Proc. Natl. Acad. Sci. U.S.A. 86:8207-8211(1989)

Purity:Greater than 90% as determined by SDS-PAGE.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Storage:The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

Lead Time Guidance:18-28 business days

Your list is ready to share