
Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 22-32 working days
Research Topic: Stem Cells
Uniprot ID: P01579
Gene Names: IFNG
Organism: Homo sapiens (Human)
AA Sequence: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRG
Expression Region: 24-161aa
Sequence Info: Full Length
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
MW: 18.2 kDa
Alternative Name(s): Immune interferon
Relevance: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.
Reference: "Cloning and expression of a novel variant of human interferon-gamma cDNA."Nishi T., Fujita T., Nishi-Takaoka C., Saito A., Matsumoto T., Sato M., Oka T., Itoh S., Yip Y.K., Vilcek J., Taniguchi T.J. Biochem. 97:153-159(1985)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer,50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Sheep Interferon gamma(IFNG)
- Regular price
- €824,95 EUR
- Sale price
- €824,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Sheep Interferon gamma(IFNG)
- Regular price
- €751,95 EUR
- Sale price
- €751,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Mouse Interferon gamma(Ifng),partial
- Regular price
- €639,95 EUR
- Sale price
- €639,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Interferon gamma(IFNG)
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out