
Size:100ug. Other sizes are also available. Please contact us.
Research Areas:Immunology
Uniprot NO.:P04233-2
Uniprot Entry Name:
Gene Names:CD74
Species:Homo sapiens (Human)
Source:Mammalian cell
Expression Region:73-232aa
Sequence:QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKESLELEDPSSGLGVTKQDLGPVPM
Protein Description:Partial of Isoform 2
Tag Info:N-terminal 10xHis-tagged
Mol. Weight:21.0 kDa
Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized Human CD74 at 2 ?g/mL can bind Anti-CD74 recombinant antibody (CSB-RA004956A1HU), the EC50 is 1.317-1.646 ng/mL.
Purity:Greater than 95% as determined by SDS-PAGE.
Endotoxin:Less than 1.0 EU/ug as determined by LAL method.
Form:Lyophilized powder
Buffer:Lyophilized from a 0.2 ?m filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0
Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Alternative Name/ Alias:(HLA-DR antigens-associated invariant chain)(Ia antigen-associated invariant chain)(Ii)(CD antigen CD74)
Relevance:Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.[Class-II-associated invariant chain peptide]: Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.[Isoform p41]: Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs). Has antiviral activity by stymieing the endosomal entry of Ebola virus and coronaviruses, including SARS-CoV-2 . Disrupts cathepsin-mediated Ebola virus glycoprotein processing, which prevents viral fusion and entry. This antiviral activity is specific to p41 isoform .
PubMed ID:
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
HGNC Database Link:
UniGene Database Link:
KEGG Database Link:
STRING Database Link:
OMIM Database Link:
You may also like
-
Recombinant Human HLA class II histocompatibility antigen gamma chain(CD74)
- Regular price
- €1.165,95 EUR
- Sale price
- €1.165,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Basigin(BSG),partial (Active)
- Regular price
- €384,95 EUR
- Sale price
- €384,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human CD44 antigen(CD44),partial (Active)
- Regular price
- €384,95 EUR
- Sale price
- €384,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Insulin growth factor-like family member 1(IGFL1) (Active)
- Regular price
- €506,95 EUR
- Sale price
- €506,95 EUR
- Regular price
-
- Unit price
- per
Sold out