Recombinant Human Glutathione S-transferase kappa 1(GSTK1),partial (Active)

Recombinant Human Glutathione S-transferase kappa 1(GSTK1),partial (Active)

CSB-EP009978HU
Regular price
€1.502,95 EUR
Sale price
€1.502,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:1mg. Other sizes are also available. Please contact us.

Research Areas:Tags & Cell Markers

Uniprot NO.:Q9Y2Q3

Uniprot Entry Name:

Gene Names:GSTK1

Species:Homo sapiens (Human)

Source:E.coli

Expression Region:2-226aa

Sequence:GPLPRTVELFYDVLSPYSWLGFEILCRYQNIWNINLQLRPSLITGIMKDSGNKPPGLLPRKGLYMANDLKLLRHHLQIPIHFPKDFLSVMLEKGSLSAMRFLTAVNLEHPEMLEKASRELWMRVWSRNEDITEPQSILAAAEKAGMSAEQAQGLLEKIATPKVKNQLKETTEAACRYGAFGLPITVAHVDGQTHMLFGSDRMELLAHLLGEKWMGPIPPAVNARL

Protein Description:Partial

Tag Info:N-terminal GST-tagged

Mol. Weight:52.4 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized HTR1B at 5 ?g/ml can bind human GSTK1,the EC50 of human GSTK1 protein is 159.40-218.50 ng/ml.

Purity:Greater than 90% as determined by SDS-PAGE.

Endotoxin:Not test.

Form:Liquid or Lyophilized powder

Buffer:If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:GST 13-13 GST class-kappa GSTK1-1

Relevance:Significant glutathione conjugating activity is found only with the model substrate, 1-chloro-2,4-dinitrobenzene (CDNB).

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human N-terminal Xaa-Pro-Lys N-methyltransferase 1(NTMT1) (Active)
    Regular price
    €1.502,95 EUR
    Sale price
    €1.502,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human SIN3-HDAC complex-associated factor(SINHCAF) (Active)
    Regular price
    €683,95 EUR
    Sale price
    €683,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Glutathione S-transferase P(GSTP1)
    Regular price
    €506,95 EUR
    Sale price
    €506,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Glutathione S-transferase P(GSTP1)
    Regular price
    €506,95 EUR
    Sale price
    €506,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share