
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: others
Target / Protein: FOXM1
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: Q08050
AA Sequence: ERPPYSYMAMIQFAINSTERKRMTLKDIYTWIEDHFPYFKHIAKPGWKNSIRHNLSLHDMFVRETSANGKVSFWTIHPSANRYLTLDQVFKPL
Tag info: N-terminal 10xHis-SUMO-tagged and C-terminal Myc-tagged
Expression Region: 235-327aa
Protein length: Partial
MW: 31.2 kDa
Alternative Name(s): Forkhead-related protein FKHL16 Hepatocyte nuclear factor 3 forkhead homolog 11
Relevance: Transcriptional factor regulating the expression of cell cycle genes essential for DNA replication and mitosis. Plays a role in the control of cell proliferation. Plays also a role in DNA breaks repair participating in the DNA damage checkpoint response.
Reference: "Hepatocyte nuclear factor 3/fork head homolog 11 is expressed in proliferating epithelial and mesenchymal cells of embryonic and adult tissues." Ye H., Kelly T.F., Samadani U., Lim L., Rubio S., Overdier D.G., Roebuck K.A., Costa R.H. Mol. Cell. Biol. 17:1626-1641(1997)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Forkhead box protein M1(FOxM1),partial
- Regular price
- €572,95 EUR
- Sale price
- €572,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Forkhead box protein O3(FOXO3),partial
- Regular price
- €647,95 EUR
- Sale price
- €647,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Fc receptor-like protein 6(FCRL6),partial
- Regular price
- €572,95 EUR
- Sale price
- €572,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Fc receptor-like protein 6(FCRL6),partial
- Regular price
- €572,95 EUR
- Sale price
- €572,95 EUR
- Regular price
-
- Unit price
- per
Sold out