Recombinant Human Fc receptor-like protein 6(FCRL6),partial

Recombinant Human Fc receptor-like protein 6(FCRL6),partial

CSB-EP718779HU
Regular price
€565,95 EUR
Sale price
€565,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug

Updated Date: Stock Protein updated on 20170405

Research areas: Immunology

Target / Protein: FCRL6

Biologically active: Not Tested

Expression system: E.coli

Species of origin: Homo sapiens (Human)

Delivery time: 3-7 business days

Uniprot ID: Q6DN72

AA Sequence: LYLQAWPNPVFEGDALTLRCQGWKNTPLSQVKFYRDGKFLHFSKENQTLSMGAATVQSRGQYSCSGQVMYIPQTFTQTSETAMVQVQELFPPPVLSAIPSPEPREGSLVTLRCQTKLHPLRSALRLLFSFHKDGHTLQDRGPHPELCIPGAKEGDSGLYWCEVAPEGGQVQKQSPQLEVRVQAPVSRPVLTLHHGPADPAVGDMVQLLCEAQRGSPPILYSFYLDEKIVGNHSAPCGGTTSLLFPVKSEQDAGNYSCEAENSVSRERSEPKKLSLKGSQVLFTPASNW

Tag info: N-terminal 6xHis-tagged

Expression Region: 20-307aa

Protein length: Extracellular Domain

MW: 35.7 kDa

Alternative Name(s): Fc receptor homolog 6

Relevance:

Reference: "FcRL6, a new ITIM-bearing receptor on cytolytic cells, is broadly expressed by lymphocytes following HIV-1 infection."Wilson T.J., Presti R.M., Tassi I., Overton E.T., Cella M., Colonna M.Blood 109:3786-3793(2007)

Purity: Greater than 90% as determined by SDS-PAGE.

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

You may also like

  • Recombinant Human Fc receptor-like protein 6(FCRL6),partial
    Regular price
    €637,95 EUR
    Sale price
    €637,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Fc receptor-like protein 6(FCRL6),partial
    Regular price
    €565,95 EUR
    Sale price
    €565,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human HLA-C protein(HLA-C),partial
    Regular price
    €499,95 EUR
    Sale price
    €499,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Acetylcholine receptor subunit alpha(CHRNA1),partial
    Regular price
    €499,95 EUR
    Sale price
    €499,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share