Size: 200ug. Other sizes are also available. Please Inquire.
In Stock: No
Lead time: 10-20 working days
Research Topic: Immunology
Uniprot ID: Q8TDQ1
Gene Names: CD300LF
Organism: Homo sapiens (Human)
AA Sequence: TQITGPTTVNGLERGSLTVQCVYRSGWETYLKWWCRGAIWRDCKILVKTSGSEQEVKRDRVSIKDNQKNRTFTVTMEDLMKTDADTYWCGIEKTGNDLGVTVQVTIDPAPVTQEETSSSPTLTGHHLDNRHKLLKLS
Expression Region: 20-156aa
Sequence Info: Extracellular Domain
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
MW: 19.5 kDa
Alternative Name(s): CD300 antigen-like family member FImmune receptor expressed on myeloid cells 1 ;IREM-1Immunoglobulin superfamily member 13 ;IgSF13NK inhibitory receptor; CD300f
Relevance: Acts as an inhibitory receptor for myeloid cells and mast cells. Inhibits osteoclast formation.
Reference: IgSF13, a novel human inhibitory receptor of the immunoglobulin superfamily, is preferentially expressed in dendritic cells and monocytes.Sui L., Li N., Liu Q., Zhang W., Wan T., Wang B., Luo K., Sun H., Cao X.Biochem. Biophys. Res. Commun. 319:920-928(2004)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage Buffer: Tris-based buffer，50% glycerol
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.