Recombinant Human CD276 antigen(CD276),partial (Active)

Recombinant Human CD276 antigen(CD276),partial (Active)

CSB-MP733578HU
Regular price
€323,95 EUR
Sale price
€323,95 EUR
Regular price
Sold out
Unit price
per 
Shipping calculated at checkout.
 More payment options

Size:100ug. Other sizes are also available. Please contact us.

Research Areas:Cancer

Uniprot NO.:Q5ZPR3

Uniprot Entry Name:

Gene Names:CD276

Species:Homo sapiens (Human)

Source:Mammalian cell

Expression Region:29-245aa

Sequence:LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYQGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSILRVVLGANGTYSCLVRNPVLQQDAHSSVTITPQRSPTG

Protein Description:Partial

Tag Info:C-terminal hFc-Myc-tagged

Mol. Weight:53.4 kDa

Biological_Activity:Measured by its binding ability in a functional ELISA. Immobilized CD276 at 2 ?g/ml can bind Anti-CD276 rabbit monoclonal antibody, the EC50 of human CD276 protein is 1.961-2.243 ng/ml.

Purity:Greater than 93% as determined by SDS-PAGE.

Endotoxin:Less than 1.0 EU/ug as determined by LAL method.

Form:Lyophilized powder

Buffer:Lyophilized from a 0.2 ?m filtered PBS, 6% Trehalose, pH 7.4

Reconstitution:We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Alternative Name/ Alias:4Ig-B7-H3 (B7 homolog 3) (B7-H3) (Costimulatory molecule) (CD276)

Relevance:May participate in the regulation of T-cell-mediated immune response. May play a protective role in tumor cells by inhibiting natural-killer mediated cell lysis as well as a role of marker for detection of neuroblastoma cells. May be involved in the development of acute and chronic transplant rejection and in the regulation of lymphocytic activity at mucosal surfaces. Could also play a key role in providing the placenta and fetus with a suitable immunological environment throughout pregnancy. Both isoform 1 and isoform 2 appear to be redundant in their ability to modulate CD4 T-cell responses. Isoform 2 is shown to enhance the induction of cytotoxic T-cells and selectively stimulates interferon gamma production in the presence of T-cell receptor signaling.

PubMed ID:

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

HGNC Database Link:

UniGene Database Link:

KEGG Database Link:

STRING Database Link:

OMIM Database Link:

You may also like

  • Recombinant Human CD226 antigen(CD226),partial (Active)
    Regular price
    €363,95 EUR
    Sale price
    €363,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Programmed cell death 1 ligand 1(CD274),partial (Active)
    Regular price
    €275,95 EUR
    Sale price
    €275,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human T-cell antigen CD7(CD7),partial (Active)
    Regular price
    €363,95 EUR
    Sale price
    €363,95 EUR
    Regular price
    Unit price
    per 
    Sold out
  • Recombinant Human Myeloid cell surface antigen CD33(CD33),partial (Active)
    Regular price
    €275,95 EUR
    Sale price
    €275,95 EUR
    Regular price
    Unit price
    per 
    Sold out

Your list is ready to share