
>Several Other Sizes Are Also Available. Please Inquire. Default Size: 200ug
Updated Date: Stock Protein updated on 20170405
Research areas: Immunology
Target / Protein: CEACAM8
Biologically active: Not Tested
Expression system: E.coli
Species of origin: Homo sapiens (Human)
Delivery time: 3-7 business days
Uniprot ID: P31997
AA Sequence: QLTIEAVPSNAAEGKEVLLLVHNLPQDPRGYNWYKGETVDANRRIIGYVISNQQITPGPAYSNRETIYPNASLLMRNVTRNDTGSYTLQVIKLNLMSEEVTGQFSVHPETPKPSISSNNSNPVEDKDAVAFTCEPETQNTTYLWWVNGQSLPVSPRLQLSNGNRTLTLLSVTRNDVGPYECEIQNPASANFSDPVTLNVLYGPDAPTISPSDTYYHAGVNLNLSCHAASNPPSQYSWSVNGTFQQYTQKLFIPNITTKNSGSYACHTTNSATGRNRTTVRMITVSD
Tag info: N-terminal 6xHis-SUMO-tagged
Expression Region: 35-320aa
Protein length: Full Length of Mature Protein
MW: 47.5 kDa
Alternative Name(s): CD67 antigen Carcinoembryonic antigen CGM6 Non-specific cross-reacting antigen NCA-95 CD_antigen: CD66b
Relevance:
Reference: "High expression of CEACAM6 and CEACAM8 mRNA in acute lymphoblastic leukemias." Lasa A., Serrano E., Carricondo M., Carnicer M.J., Brunet S., Badell I., Sierra J., Aventin A., Nomdedeu J.F. Ann. Hematol. 87:205-211(2008)
Purity: Greater than 90% as determined by SDS-PAGE.
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20℃/-80℃. The shelf life of lyophilized form is 12 months at -20℃/-80℃.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
You may also like
-
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 8(CEACAM8)
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 7(CEACAM7)
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 6(CEACAM6)
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out -
Recombinant Human Carcinoembryonic antigen-related cell adhesion molecule 1(CEACAM1),partial
- Regular price
- €499,95 EUR
- Sale price
- €499,95 EUR
- Regular price
-
- Unit price
- per
Sold out